PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_37856
Common NameKK1_042168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRAS
Protein Properties Length: 590aa    MW: 66801.4 Da    PI: 4.7528
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_37856genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.12.7e-922195882374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselyka.l.ppsetseknsseelaalkl.fsevsPilkfs 94 
                     e Ll+ Ae v  +++e+a++lL++ + l+ ++g+p +R+++yf+eAL++r+ r++ +++++ l + ++ ++++ ++el+ + + f+e  P+ +++
  C.cajan_37856 219 AESLLASAEKVGYQQFERANKLLNHCESLSCKTGSPAKRIVHYFAEALRHRIDRETGRVSSKdLqKGQSFDPEKAARELNPTIVaFYEWLPFCQIA 314
                    57899*************************************************6666654414333444444555555544447*********** PP

           GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +ta qaI e v++++++H+iD++i +G++W  L+qaLasR+ +   l+iT+++  +   ++ +e tg+rL++fA+ l++pf+fn++++++l +l+
  C.cajan_37856 315 LFTAVQAIIEDVAEAKKIHVIDLEIRKGGHWTILMQALASRQCPIELLKITAIETGT--TSHIVEDTGKRLKEFAQGLNIPFSFNIVMVSDLLQLR 408
                    *******************************************************44..9999********************************* PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     ++++++p+EalaV + ++l +  ++s +le     ++++++  sP+v+vv+e ea+hns+sF++rf+eal y+sa+fd+lea + +e+e+r+ +E
  C.cajan_37856 409 EDHFEIDPEEALAVYSNYALRSRIQDSEQLET----IMRVIRAFSPNVMVVTEIEANHNSTSFVNRFIEALFYFSAFFDCLEACM-KEDENRTIIE 499
                    ************************99999998....***********************************************96.8899****** PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +++  i+n+va+egaer+ r+ +   Wr+ ++++G+ + +ls+    qa+l+ ++++ +   + +++  sl+ gWk+ p+ svS+W+
  C.cajan_37856 500 SLYFSYGIRNIVAAEGAERKTRNVKIDVWRAFFSRFGMVEKELSTLSLYQAELVAKRFPcGSFCTFDKNGLSLLVGWKGTPINSVSVWK 588
                    ***********************************************************666567777788899**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.247192567IPR005202Transcription factor GRAS
PfamPF035149.4E-90219588IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MEDLYHVSFS TVDDNSSSSS DIFWEGLNDV KKVQFSGAED QGENGGIDSL YSDFGFFQYD  60
PSEEGYLVST NQQKYQQLPS YHHYHDYGQL DNLQFDMVSP PLQFDAQFPT MAPLCDSTKD  120
KPYSSAPLAS LEILKNYGKG FKRLCNEGQT LQAVDDLAMA TNDVIWRKLS TEDIMRIAGT  180
RFIQSSSSDS EPLPFLENHP FAASFSGLSD EEKEDVALAE SLLASAEKVG YQQFERANKL  240
LNHCESLSCK TGSPAKRIVH YFAEALRHRI DRETGRVSSK DLQKGQSFDP EKAARELNPT  300
IVAFYEWLPF CQIALFTAVQ AIIEDVAEAK KIHVIDLEIR KGGHWTILMQ ALASRQCPIE  360
LLKITAIETG TTSHIVEDTG KRLKEFAQGL NIPFSFNIVM VSDLLQLRED HFEIDPEEAL  420
AVYSNYALRS RIQDSEQLET IMRVIRAFSP NVMVVTEIEA NHNSTSFVNR FIEALFYFSA  480
FFDCLEACMK EDENRTIIES LYFSYGIRNI VAAEGAERKT RNVKIDVWRA FFSRFGMVEK  540
ELSTLSLYQA ELVAKRFPCG SFCTFDKNGL SLLVGWKGTP INSVSVWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3524158826375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147356.10.0hypothetical protein PHAVU_006G117200g
TrEMBLA0A151R2H40.0A0A151R2H4_CAJCA; DELLA protein RGL2
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-51RGA-like 2